Lab Grown Black Diamond Floral Engagement Ring with White Diamond Accents

Sale price £305.00 Regular price £350.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Created for a love story with its own character, this lab grown black and white diamond flower engagement ring centers on the dramatic contrast of a round black diamond framed by a nature-inspired floral motif. The dark center and bright white diamond accents give the design a distinctive presence for a proposal, anniversary, milestone, or meaningful jewelry gift. Crafted in 92.5 sterling silver, the ring pairs expressive symbolism with a refined, wearable profile.

0.84 Carat Round Black Diamond Flower Engagement Ring with White Diamond Accents

The focal point is an approximately 0.84 carat synthetic black diamond measuring about 5 x 5 mm. Its round shape and brilliant cut are secured in a prong setting and incorporated into the flower-inspired centerpiece. Along the ring, 36 round brilliant-cut white diamonds contribute approximately 0.14 carat in combined accent weight, creating crisp contrast against the black center stone. The ring measures approximately 6 mm in width and 8 mm in height.

Black and White Diamond Flower Ring Details

  • Center stone: One approximately 0.84 carat, 5 mm round synthetic black diamond with a brilliant cut.
  • Setting: Prong-set center and accent stones.
  • Diamond accents: 36 round brilliant-cut white diamonds totaling approximately 0.14 carat.
  • Accent quality: H-I color and SI quality grade.
  • Center stone quality: AAAA synthetic grade.
  • Metal: Available in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K.
  • Dimensions: Approximately 6 mm wide and 8 mm high.

The combination of a dark central diamond and numerous bright accents makes the floral arrangement easy to notice without relying on an oversized silhouette.

Why Choose a Black Diamond Flower Engagement Ring

The flower motif gives this engagement ring a natural association with growth, new beginnings, and a relationship that continues to develop over time. Its black-and-white stone pairing adds another layer of meaning: the deep center creates strength and individuality, while the surrounding white diamonds bring light and contrast. The round brilliant cuts help both the center and accents interact with light, while prong settings keep the stones visually prominent. It is a compelling choice for someone who wants an engagement ring that feels expressive rather than conventional.

Certified Lab Grown Black Diamond Ring Craftsmanship

Rosec Jewels carefully crafts and finishes this lab grown black diamond engagement ring with attention to stone placement, setting security, and overall presentation. Each piece goes through stone inspection, a setting-security review, and a finishing inspection before dispatch, and a Certificate of Authenticity is provided with the jewelry for added product confidence. The ring is also supported with care guidance to help preserve its finish and the appearance of its stones over time. The jewelry is presented as certified jewelry and is checked by hand.

Styling a Black and White Diamond Engagement Ring

From above, the round black center creates a strong focal point within the floral design, while the smaller white diamonds carry brightness across the ring. The contrasting stones make it easy to wear as a standalone statement, whether paired with everyday neutrals, evening looks, or other sterling silver jewelry. Offered across a broad range of US ring sizes, it can be chosen as a distinctive proposal ring, a commitment piece, or a symbolic gift for someone drawn to nature-inspired and unconventional diamond jewelry.

Product Information
SKU SHP-RINGS0821187964
Width 6 mm
Height 8 mm
Metal Weight 3.83 gm (Approximate)
Center Stone Weight 0.84 Carat (Approximate)
SYNTHETIC BLACK DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.84 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA ( Synthetic )
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-black-diamond-engagement-rings

FAQs About: Certified 0.8 Carat Lab Grown Black and White Diamond Flower Engagement Ring

What makes this black and white diamond flower ring suitable for an engagement?

The ring combines an approximately 0.84 carat round black diamond with white diamond accents in a flower-inspired design. The floral motif can represent growth and new beginnings, giving the ring meaningful symbolism for a proposal or commitment while offering a distinctive alternative to a traditional all-white diamond engagement ring.

What stone cut and setting are used in this lab grown black diamond engagement ring?

The approximately 5 mm black center diamond has a round shape and brilliant cut and is held in a prong setting. The 36 white diamond accents are also round, brilliant cut, and prong set.

How many white diamond accent stones are in the flower engagement ring?

The design contains 36 round white diamond accent stones with a combined approximate weight of 0.14 carat. They are graded H-I for color and SI for quality and create the bright contrast around the black diamond focal point.

What metal is used for this black diamond flower engagement ring?

This ring is crafted in 92.5 sterling silver. Its light-toned metal complements the white diamond accents while emphasizing the contrast of the black center diamond.

Does the black and white diamond ring come with an authenticity certificate?

Yes. Rosec Jewels provides a Certificate of Authenticity with the jewelry. The piece also goes through stone inspection, setting-security review, and finishing inspection before dispatch for additional product confidence.

Can this flower engagement ring be worn regularly?

It can be incorporated into regular wear with appropriate jewelry care. Because the ring uses prong-set stones, avoid unnecessary knocks, abrasive surfaces, harsh chemicals, and activities that could place pressure on the settings. Periodically checking the prongs is also a sensible way to help maintain stone security.

How should I care for a sterling silver black and white diamond ring?

Store the ring separately when it is not being worn and keep it away from harsh household chemicals, cosmetics, and abrasive materials. Clean it gently with jewelry-appropriate methods and pay particular attention to the prong-set areas, where residue can collect around the black center diamond and smaller white accents.