Lab Grown Diamond Cocktail Necklace With Emerald Ruby

Regular price £945.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

The Diamond Floral Necklace represents a timeless and elegant addition to any jewelry collection, radiating a sense of feminine allure. Its exquisite flower motif is designed to attract attention and admiration. The Cocktail Necklace features a breathtaking array of various gemstones, resulting in a captivating visual display. At its heart lies an 8 MM Round Shape lab-grown Diamond, securely held in prong setting. Additionally, the Halo Necklace is adorned with small round rubies, diamonds, and oval-shaped emeralds with vintage-inspired designs that make a bold statement. This sophisticated Floral Inspired Diamond Pendant embodies the beauty of nature and is a perfect expression of your affection. You can have confidence in the quality of our offerings, as each piece is accompanied by a certificate of authenticity.

Product Information
SKU SHP-PENDANT022510039
Metal Weight 4.50 gm (Approximate)
Total Stone Weight 3.23 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 2.22 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-10 Pcs
Round-1.50X1.50 mm-5 Pcs
Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
EMERALD INFORMATION
No.of Stones 10 Pieces
Total Weight 1.02 Carat (Approximate)
Dimension(approx) Oval-3X4 mm-5 Pcs
Round-2X2 mm-5 Pcs
Color Green
Cut Brilliant
Shape Oval, Round
Setting Type Prong-Setting
Quality Grade AAA
View More