Lab Grown Diamond Nature Inspired Floral Bypass Ring

Regular price £299.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Nature-Inspired Elegance with a Modern Twist

The Lab Grown Diamond Nature Inspired Floral Bypass Ring is designed for those who appreciate organic forms paired with refined craftsmanship. The flowing bypass silhouette creates a soft wrap effect around the finger, while the floral elements add delicate visual detail.

This ring offers a distinctive alternative to traditional straight band styles, making it suitable for meaningful gifting or personal statement wear.

Floral Bypass Design Structure

The bypass setting curves gently, allowing the decorative floral motif to become the focal point. This structure enhances dimension and creates natural movement within the design.

The open crossover layout also provides balanced spacing between elements, helping the diamonds capture light from multiple angles. Specific stone dimensions, setting details, and metal options are provided in the product tables above.

Lab Grown Diamond Characteristics

Lab grown diamonds have the same physical and optical properties as natural diamonds, offering brilliance and durability suitable for everyday wear when properly cared for.

These diamonds are created without traditional mining, and their environmental impact varies by production and energy source.

High-Level Features

  • Nature inspired floral motif integrated into a bypass band.
  • Lab grown diamonds selected for consistent brilliance.
  • Distinctive crossover structure for visual dimension.
  • Complete specifications available in the product detail tables above.
Product Information
SKU SHP-RINGS082310252
Metal Weight 3.22 gm (Approximate)
Total Stone Weight 0.73 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 19 Pieces
Total Weight 0.73 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Round-1.50X1.50 mm-18 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

Product Parent Collection Handle
lab-created-diamond-rings

FAQs about: Lab Grown Diamond Nature Inspired Floral Bypass Ring

Is this ring suitable for daily wear?
Lab grown diamonds are durable for regular use. As with any fine jewelry, removing the ring during heavy impact activities can help maintain its appearance over time.
Does the bypass design affect comfort?
The bypass structure is crafted to sit comfortably along the finger. Exact band width and dimensions are provided in the product detail tables for reference.
Are lab grown diamonds real diamonds?
Yes. Lab grown diamonds have the same physical and optical properties as natural diamonds and are graded using the same standards.
What metal options are available?
Available metal choices and finishes are listed in the selectable options and detailed in the product specification tables above.
Can this ring be given as a special occasion gift?
The floral motif and elegant crossover design make it appropriate for occasions such as anniversaries, milestone celebrations, or personal keepsakes.