Lab Grown Diamond Snowflake Winter Necklace

Regular price £331.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Lab Grown Diamond Snowflake Winter Necklace

This snowflake-inspired necklace is designed for those who appreciate delicate symbolism and understated luxury. The winter motif reflects individuality and quiet elegance, making it suitable for gifting or personal wear.

Featuring a lab grown diamond as its focal point, the necklace offers visual clarity and balance without excessive ornamentation, aligning with buyers who prefer refined, meaningful jewelry.

Snowflake Design & Craftsmanship

The snowflake design is structured to create symmetry and light movement, allowing the necklace to sit naturally when worn. Each element of the design contributes to a clean, balanced silhouette rather than decorative excess.

The setting is crafted to support the diamond securely while maintaining a lightweight feel appropriate for regular wear.

Lab Grown Diamond Value

Lab grown diamonds are selected for their durability and suitability for everyday jewelry. These stones are created without traditional mining, though impact varies by production and energy source.

The diamond placement enhances light interaction while preserving the integrity of the snowflake motif.

High-Level Features

  • Snowflake-inspired winter design
  • Lab grown diamond suitable for daily wear
  • Lightweight construction for comfort
  • Balanced setting with refined proportions
Product Information
SKU SHP-PENDANT082310762
Length 22 mm
Width 19 mm
Metal Weight 4.17 gm (Approximate)
Total Stone Weight 0.91 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 46 Pieces
Total Weight 0.91 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Round-1.30X1.30 mm-45 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More
What does the snowflake design symbolize?
Snowflake designs often symbolize individuality, seasonal beauty, and quiet elegance.
Is this necklace suitable for everyday wear?
The lightweight design and secure setting make it appropriate for regular wear with proper care.
How durable is a lab grown diamond?
Lab grown diamonds share the same hardness and durability as mined diamonds.
Does the necklace sit flat on the neckline?
The design is intended to sit naturally and evenly when worn.
How should this necklace be cared for?
Clean gently with a soft cloth and mild solution, avoiding harsh chemicals or impact.