Lab Grown Emerald Heart Pendant Necklace with Diamonds

Sale price £217.00 Regular price £250.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Heart-Shaped Emerald Pendant with Elegant Diamond Detail

This Lab Grown Emerald Heart Pendant Necklace brings together vibrant gemstone color and a meaningful silhouette. At the center of the design is a heart-shaped emerald, admired for its rich green tone and expressive form. The heart motif naturally symbolizes affection and connection, making the pendant a thoughtful jewelry choice for meaningful occasions.

Surrounding diamond accents add subtle brilliance that enhances the overall design without overshadowing the emerald centerpiece. The result is a necklace that balances color and sparkle in a refined and graceful way.

A Pendant Design That Highlights the Heart Motif

The pendant is designed to emphasize the distinctive heart shape of the emerald. Its smooth curves create a soft and elegant outline that naturally draws attention to the gemstone while maintaining a balanced composition.

Diamonds placed within the design introduce gentle light reflection, helping to accentuate the contours of the pendant. This thoughtful arrangement enhances the overall visual harmony while preserving the central focus on the emerald.

The Beauty of Lab Grown Emerald

Lab grown emeralds offer the same striking green appearance that has made emerald a beloved gemstone in jewelry for centuries. Their vivid color creates a distinctive presence that pairs beautifully with the sparkle of diamonds.

Lab grown emeralds are created without traditional mining. As with all lab created gemstones, environmental impact can vary depending on production methods and energy sources.

A Meaningful Necklace for Special Moments

Heart-shaped jewelry is often chosen to celebrate affection, important relationships, and memorable occasions. The emerald centerpiece brings a bold yet elegant color to the design, while the diamond accents add refined brilliance.

Whether selected as a thoughtful gift or a personal jewelry piece, this pendant necklace offers a graceful combination of symbolism, gemstone beauty, and timeless style.

Product Information
SKU SHP-PENDANT122310067
Metal Weight 2.70 gm (Approximate)
Total Stone Weight 1.41 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 1.26 Carat (Approximate)
Dimension(approx) Oval-6X8 mm-1 Pcs
Color Green
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 21 Pieces
Total Weight 0.15 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-11 Pcs
Round-1.20X1.20 mm-10 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs About: Lab Grown Emerald Heart Pendant Necklace with Diamonds

What does a heart-shaped pendant symbolize?
Heart-shaped pendants are often associated with love, affection, and meaningful relationships. They are commonly chosen as gifts to represent emotional connection.
What is a lab grown emerald?
A lab grown emerald is created in controlled environments to replicate the appearance and properties of natural emerald. These gemstones display the same rich green color associated with traditional emerald jewelry.
Why are diamonds used with emerald in jewelry?
Diamonds are often paired with emeralds because their sparkle contrasts beautifully with the deep green gemstone. This combination highlights the color of the emerald while adding refined brilliance.
Can this pendant be worn daily?
Many gemstone pendants are suitable for everyday wear when handled with proper care. Their versatile design allows them to complement both casual and formal outfits.
Is a heart emerald necklace suitable as a gift?
Yes, heart-shaped emerald necklaces are often chosen as gifts for anniversaries, birthdays, and romantic occasions because they combine symbolism with elegant gemstone design.
Can this necklace be layered with other jewelry?
The elegant pendant design makes it easy to wear alone or layered with other delicate necklaces for a more personalized jewelry style.