Lab Grown Emerald Infinity Heart Stud Earrings

Sale price £180.00 Regular price £207.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbolic Design with Everyday Elegance

The Lab Grown Emerald Infinity Heart Stud Earrings are designed for those who appreciate meaning in their jewelry. Combining the infinity motif with a heart shape, this design reflects continuity and connection while maintaining a refined, wearable form.

These earrings are ideal for everyday styling or as a thoughtful gift that carries symbolic significance.

Why the Infinity Heart Design Stands Out

The infinity element adds a sense of flow to the structure, while the heart shape introduces a familiar and expressive form. Together, they create a balanced design that feels both distinctive and easy to wear.

The stud format keeps the earrings close to the ear, making them practical for regular use without compromising on visual detail.

Lab Grown Emerald as a Center Stone

Lab grown emeralds are chosen for their vivid green color and consistent appearance. They are created without traditional mining, though their overall impact varies depending on production and energy source.

Their rich tone provides contrast within the design, helping define the shape while adding depth to the overall look.

High-Level Features Buyers Appreciate

The compact stud design ensures ease of wear, while the symbolic shape adds a personal element to the piece. Its proportions allow it to work well as a standalone accessory or paired with other jewelry.

The combination of color and form makes these earrings versatile for both casual and occasion-based styling.

Product Information
SKU SHP-EARRINGS042163811
Length 6.5 mm
Width 10.6 mm
Metal Weight 1.91 gm (Approximate)
Total Stone Weight 0.24 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 2 Pieces
Total Weight 0.24 Carat (Approximate)
Dimension(approx) Round-3X3 mm-2 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
View More

FAQs About: Lab Grown Emerald Infinity Heart Stud Earrings

What does the infinity heart design represent?
The infinity heart combines symbols of continuity and affection, often associated with lasting connections and meaningful relationships.
Are these earrings suitable for daily wear?
Yes, the stud design makes them suitable for everyday wear due to their secure and close-fitting structure.
What is a lab grown emerald?
A lab grown emerald is created without traditional mining and offers a similar appearance to natural emerald, with consistent color and clarity.
Can these earrings be worn with other jewelry?
Yes, their simple and symbolic design allows them to pair easily with other pieces for a coordinated look.
Are stud earrings comfortable for long wear?
Stud earrings are generally designed for comfort, sitting close to the ear and remaining stable throughout the day.
Who are these earrings best suited for?
They are ideal for those who prefer meaningful, symbolic jewelry with a clean and wearable design.