Marquise Blue Sapphire Butterfly Helix Earring with Diamond

Sale price £399.00 Regular price £439.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Delicate, eye-catching, and full of charm, the Butterfly Helix Earring is designed to captivate with its graceful beauty. Inspired by the elegance of nature, this stunning piece features a butterfly motif adorned with marquise cut blue sapphires that form the wings. Accentuating the design are sparkling round cut lab grown diamonds, carefully set to enhance brilliance and add a shimmer to every movement. Crafted to complement both modern and classic styles, this Blue Sapphire Cartilage Earring effortlessly elevates any look - whether you are dressing casually or for a special occasion. Its versatile design makes it perfect for styling across multiple piercings, including helix, cartilage, conch, tragus, or upper lobe, allowing you to express your individuality with ease. Thoughtfully designed for comfort as well as beauty, the Sapphire and Diamond Earring features a flat-back closure that sits smoothly against the skin. Whether you are searching for a meaningful gift or a unique addition to your own jewelry collection, this Butterfly Piercing Earring is a perfect choice. It makes a thoughtful graduation gift, symbolizing growth, transformation, and new beginnings. It is equally suited for birthdays, anniversaries, or any special moment worth celebrating.

Product Information
SKU SHP-BODYJ012210171
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 0.54 Carat (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Marquise-2.50X5.00 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
helix-earrings