Marquise Shape Diamond Leaf Crawler Helix Earring

Sale price £258.00 Regular price £297.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Modern Leaf-Inspired Ear Statement

The Marquise Shape Diamond Leaf Crawler Helix Earring is designed for those who prefer sculptural elegance along the ear. Inspired by the natural curve of a leaf, this crawler style follows the contour of the helix, creating a refined yet contemporary look. The marquise-shaped diamonds enhance the organic silhouette with elongated brilliance.

Design & Setting Perspective

The leaf-inspired layout arranges marquise diamonds in a flowing pattern that mimics natural foliage. This structure allows the earring to sit along the ear rather than hang downward, offering a streamlined profile. The setting secures each diamond while maintaining a delicate appearance suited for curated ear styling.

Stone Character & Wear Considerations

Diamonds are valued for their durability and light performance. The marquise shape adds a distinctive elongated sparkle that complements the crawler design. With proper insertion and secure fastening, this helix earring is suitable for regular wear. Removing jewelry during activities that may cause impact helps preserve its structure and finish.

High-Level Features Buyers Consider

  • Marquise-shaped diamonds: elongated brilliance enhancing the leaf motif.
  • Leaf crawler design: follows the ear’s natural contour.
  • Helix styling: ideal for curated ear looks and modern layering.
  • Metal options available: select your preferred metal directly on the product page.
Product Information
SKU SHP-BODYJ0921397636
Length 6.7 mm
Width 2.8 mm
Height 1.8 mm
Metal Weight 0.35 gm (Approximate)
Total Stone Weight 0.21 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.21 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-4 Pcs
Round-1.20X1.20 mm-1 Pcs
Color HI
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
helix-earrings
Is this earring sold as a single piece or a pair?
Please refer to the product detail table to confirm whether the earring is sold individually or as a pair, as this may vary by listing.
Is this suitable for a helix piercing?
The design is intended to complement helix styling. Piercing placement and fit may vary, so reviewing the dimensions in the product specifications is recommended.
Are the diamonds natural?
The diamond details are listed in the product specifications table. Please review that section for exact information about the stones used.
Can this earring be worn daily?
With secure fastening and proper care, it can be worn regularly. Removing it during strenuous activities helps maintain its finish and structure.
How should I clean this diamond helix earring?
Clean gently with mild soap and warm water using a soft cloth or brush. Avoid harsh chemicals and store separately when not in use.