Modern Flower Pendant with Round Created Ruby and Diamond

Regular price £379.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

If you fancy all things delicate and shiny, this modern flower pendant deserves all your attention. Set with an eye-pleasing floral motif, round Diamond and created ruby, the heart pendant exudes a distinctive classic charm. Connected with a lustrous bale, the necklace pendant is a glamorous option for every fashion-savvy.

Product Information
SKU SHP-PENDANT032214542
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 0.91 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.26 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-4 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-8 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1X1 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-ruby-necklace