Moissanite Flower Cartilage Earring for Women

Sale price £305.00 Regular price £351.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Delicate Floral Design for Cartilage Styling

The Moissanite Flower Cartilage Earring in Gold is crafted for those who prefer subtle, refined jewelry for curated ear looks. The floral design introduces a soft decorative element, making it suitable for both minimal and layered styling.

Its compact form allows it to sit neatly on the ear, enhancing overall balance without overwhelming the look.

Thoughtful Structure for Secure Fit

Designed specifically for cartilage placement, this earring offers a structure that supports stability and ease of wear. Its size and shape are suited for close placement, ensuring it complements other earrings without crowding.

The floral arrangement adds visual interest while maintaining a clean and wearable profile.

Moissanite for Light Reflection

Moissanite is chosen for its bright appearance and clarity, providing a subtle sparkle that enhances the overall design. It is created without traditional mining, though its environmental impact varies depending on production and energy sources.

This makes it a suitable option for those seeking a modern alternative with consistent visual quality.

High-Level Features Buyers Appreciate

The lightweight design supports comfortable wear throughout the day, making it ideal for cartilage piercings. Its minimal yet detailed appearance allows it to be worn alone or combined with other pieces for a curated ear style.

The floral motif and subtle sparkle make it adaptable for both casual and refined occasions.

Product Information
SKU SHP-BODYJ0921397047
Length 6.5 mm
Width 6.5 mm
Height 2.2 mm
Weight 0.90 gm (Approximate)
MOISSANITE INFORMATION
No.of Stones 10 Pieces
Total Weight 0.10 Carat (Approximate)
Dimension(approx) Round-1X1 mm-9 Pcs
Round-2X2 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Other-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
cartilage-earrings

FAQs About: Moissanite Flower Cartilage Earring in Gold

Is this earring suitable for cartilage piercings?
Yes, it is specifically designed for cartilage placement with a secure and balanced fit.
Can this earring be worn daily?
Yes, its lightweight design makes it comfortable for everyday wear.
Does the floral design look bulky?
No, the design is compact and refined, ensuring it sits neatly on the ear.
Is moissanite suitable for regular use?
Moissanite is suitable for everyday wear, though proper care helps maintain its appearance.
Can it be styled with other earrings?
Yes, it pairs well with studs, hoops, or other cartilage pieces for a layered look.
Who is this earring ideal for?
It is ideal for those who prefer delicate designs with subtle sparkle for curated ear styling.