Moissanite Snowflake Stud Earrings for Her

0
Regular price £218.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Moissanite Snowflake Stud Earrings

These stud earrings feature a snowflake-inspired design accented with moissanite gemstones that create a balanced combination of sparkle and intricate structure. The symmetrical arrangement of stones forms a delicate snowflake silhouette, offering a distinctive yet refined appearance.

The design highlights both gemstone brilliance and decorative craftsmanship, creating earrings that stand out while remaining elegant and wearable.

Snowflake Inspired Design

Snowflake jewelry designs are recognized for their symmetrical patterns and detailed structure. The arrangement of multiple small elements radiating from a central point creates a visually balanced motif.

This style introduces texture and dimension to stud earrings while maintaining a compact silhouette that sits comfortably on the ear.

Moissanite Gemstone Brilliance

Moissanite is valued for its strong brilliance and ability to reflect light across multiple facets. Its optical properties create a lively sparkle that enhances detailed jewelry designs such as cluster or patterned earrings.

Moissanite is created without traditional mining, although environmental impact can vary depending on the production process and energy sources used.

Elegant Stud Earring Style

Stud earrings are widely appreciated for their versatility and timeless appearance. Their compact structure allows them to sit close to the ear, making them suitable for both everyday wear and formal occasions.

Combining a classic stud format with a decorative snowflake motif creates jewelry that feels both modern and distinctive.

Product Information
SKU SHP-EARRINGS012148179
Length 10.2 mm
Width 9 mm
Weight 1.89 gm (Approximate)
Center Stone Weight 0.70 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 26 Pieces
Total Weight 0.70 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-12 Pcs
Round-1.60X1.60 mm-12 Pcs
Round-1.80X1.80 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-earrings

FAQs About: Moissanite Snowflake Stud Earrings for Her

What is moissanite?
Moissanite is a gemstone known for its brilliance and light reflection, making it a popular choice for modern jewelry designs.
What are snowflake stud earrings?
Snowflake stud earrings feature a symmetrical design inspired by the structure of a snowflake, often created using multiple small gemstones.
Are stud earrings suitable for everyday wear?
Stud earrings are commonly chosen for everyday jewelry because they sit close to the ear and maintain a comfortable, secure design.
Is moissanite created without traditional mining?
Yes, moissanite is created without traditional mining, although environmental impact may vary depending on production methods and energy sources.
Why are patterned earrings popular?
Patterned earrings add visual interest through symmetrical or decorative arrangements while maintaining a balanced overall design.
What makes moissanite jewelry distinctive?
Moissanite gemstones are recognized for their strong brilliance and light dispersion, which produces noticeable sparkle in jewelry.