Natural Amethyst Rose Engagement Ring with Diamond

Sale price £324.00 Regular price £364.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bloom into a beautiful new chapter of love with this enchanting Flower Engagement Ring, designed to capture romance in the most elegant way. Featuring a 5 mm Round Shape Amethyst placed within a flower motif, this fine ring symbolizes growth, beauty and a love story that blossoms more with each passing day. The graceful Curved Band, adorned with dainty Diamond stones, adds a sparkling touch that reflects everlasting devotion and unforgettable moments shared together. Inspired by the timeless charm of nature, the floral design represents new beginnings, happiness and the promise of a future filled with love and togetherness. The rich purple AAA Quality Amethyst is known as a gemstone of loyalty and peace, making this Amethyst Engagement Ring a meaningful choice for celebrating a deep emotional connection. Perfect as an engagement ring, promise ring, anniversary gift or a romantic surprise for someone truly special, this elegant Amethyst Diamond Ring combines modern style with soft, feminine beauty. Presented in a signature jewelry box and available in various ring sizes, this stunning Amethyst Ring for Women is crafted to express eternal love in a way that will always be treasured.

Product Information
SKU SHP-RINGS0821183114
Width 5.4 mm
Height 8 mm
Metal Weight 2.70 gm (Approximate)
Total Stone Weight 0.68 Carat (Approximate)
AMETHYST INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Violet
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-18 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
amethyst-engagement-rings