Natural Bezel Set Marquise Tanzanite Promise Ring with Celtic Knot

Sale price £209.00 Regular price £235.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Promise in Tanzanite

The Natural Bezel Set Marquise Tanzanite Promise Ring with Celtic Knot is designed for those who value symbolism and individuality. At its center sits a marquise-shaped natural tanzanite, chosen for its rich color and elongated silhouette. The design blends gemstone elegance with intricate Celtic knot detailing, creating a ring that carries both visual distinction and personal meaning.

Design & Setting: Bezel Security with Symbolic Detail

The bezel setting frames the marquise tanzanite in a smooth metal border, offering a streamlined appearance while protecting the edges of the stone. This setting style creates a modern, clean outline that complements the fluid curves of the Celtic knot motif. The knot design represents continuity and connection, making the ring especially suited for promise or milestone occasions.

Stone Character & Wear Considerations

Tanzanite is appreciated for its distinctive blue-violet tones that may shift subtly under different lighting conditions. As a natural gemstone, each stone displays individual depth and variation. For longevity, it is recommended to remove the ring during high-impact activities and store it separately when not in use.

High-Level Features Buyers Consider

  • Natural marquise tanzanite: elongated shape for a refined, flattering profile.
  • Bezel setting: smooth metal frame that enhances security and clean lines.
  • Celtic knot design: symbolic detailing representing unity and continuity.
  • Metal options available: select your preferred metal directly on the product page.
Product Information
SKU SHP-RINGS112029305
Width 2.4 mm
Height 8.2 mm
Metal Weight 2.33 gm (Approximate)
Center Stone Weight 0.68 Carat (Approximate)
TANZANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.68 Carat (Approximate)
Dimension(approx) Marquise-4X8 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Marquise
Setting Type Bezel Setting
Quality Grade AAA
View More

Product Parent Collection Handle
tanzanite-rings
Is the tanzanite in this ring natural?
Yes, this ring features a natural tanzanite center stone. Natural gemstones may display subtle variations in color and tone.
What are the benefits of a bezel setting?
A bezel setting surrounds the stone with a protective metal rim, helping shield the edges while offering a smooth and contemporary appearance.
Is this ring suitable for everyday wear?
It can be worn regularly with proper care. Removing the ring during strenuous activities and following routine maintenance helps preserve its condition.
What does the Celtic knot design symbolize?
Celtic knot motifs traditionally represent continuity, unity, and interconnectedness, making them meaningful for promise or milestone jewelry.
How should I care for this tanzanite ring?
Clean gently with mild soap and warm water, then dry with a soft cloth. Avoid harsh chemicals and ultrasonic cleaners.