Natural Black Opal Flower Pendant Necklace for Women

Sale price £228.00 Regular price £256.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the delicate beauty of nature, this Flower Pendant Necklace is a perfect blend of elegance and charm. At the center of the design sits a 5 mm Round Black Opal set in Bezel Setting, its rich hues glowing with every angle and capturing attention effortlessly. Surrounding the AAA Quality Opal, the flower motif adds a soft, feminine touch, turning a simple pendant into a statement piece that feels natural and timeless. Ideal for women who love jewelry that is both versatile and eye-catching, this Black Opal Pendant Necklace works beautifully with casual daywear or as a sparkling accent for evening outfits. The harmonious contrast between the dark, vibrant Black Opal and the elegant Floral design creates a piece that is truly one-of-a-kind. Whether you are looking to elevate your everyday look or add a touch of nature-inspired elegance to a special occasion, this Opal Necklace for Women brings a touch of magic, sophistication and personality to any wardrobe.

Product Information
SKU SHP-PENDANT032215681
Length 18.5 mm
Width 15 mm
Metal Weight 5.30 gm (Approximate)
Total Stone Weight 0.45 Carat (Approximate)
BLACK OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
black-opal-necklace