Natural Diamond Heart Chain Bracelet with Bezel Setting

Sale price £281.00 Regular price £323.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Keep a symbol of affection close with this bezel set diamond heart chain bracelet, designed around an open heart motif and subtle diamond sparkle. The delicate chain gives the bracelet a light, streamlined look, while round brilliant-cut diamonds add polished points of light without overpowering the heart centerpiece. Meaningful enough for an anniversary, birthday, romantic occasion, or just-because gift, it also works as a personal reminder of love and connection.

0.28 Carat Bezel Set Diamond Heart Chain Bracelet

Two round brilliant-cut diamonds measuring approximately 3 x 3 mm each bring a combined stone weight of approximately 0.28 carat to the design. Smooth bezel settings frame the diamonds in metal, creating a clean outline that complements the minimalist heart motif. Crafted in 92.5 sterling silver, the bracelet measures approximately 177.8 mm in length, 7.3 mm in width, and 2 mm in height, with an approximate metal weight of 2.65 grams. Gemstone quality selections include Lab (EF-VS) and Natural (HI-SI).

What Makes This Diamond Heart Bracelet Special

  • Heart-centered design: An open heart motif gives the chain bracelet a clear association with affection, connection, and meaningful relationships.
  • 0.28 carat diamond weight: Two round diamonds contribute approximately 0.28 carat in combined stone weight.
  • Brilliant-cut sparkle: The round diamonds use brilliant faceting for a bright accent against the refined chain.
  • Bezel settings: Smooth metal rims surround the diamonds, giving the stones a neat, low-detail frame rather than exposed prongs.
  • Diamond quality choice: The bracelet is offered with Lab (EF-VS) and Natural (HI-SI) gemstone quality selections.
  • Metal: Available in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K.

Its combination of symbolic detail and restrained sparkle makes the bracelet easy to compare with more ornate heart jewelry while retaining a distinctly minimal profile.

Heart Motif and Bezel-Set Diamond Design Meaning

The heart has an immediate emotional connection to love, care, and close relationships, while the diamond accents add a sense of celebration without taking attention away from the symbol itself. Bezel settings reinforce the bracelet's clean styling by surrounding each round stone with a smooth metal edge. Together, these details make the piece a thoughtful choice for marking an anniversary, relationship milestone, friendship, family bond, or personal moment with jewelry that carries meaning without feeling overly formal.

Diamond Heart Bracelet Authenticity & Craftsmanship

Rosec Jewels crafts this diamond heart bracelet with attention to stone placement, bezel-setting security, chain detailing, and refined finishing. A Certificate of Authenticity is offered with the jewelry for added product confidence. Before dispatch, each piece goes through stone inspection, setting security review, and finishing inspection, with care guidance provided to support long-term ownership. The jewelry is also presented as certified jewelry and checked by hand.

Styling a Bezel Set Diamond Heart Bracelet

The slim chain and open heart motif give this bracelet enough character to wear alone while keeping the profile easy to layer with other fine chain bracelets. Its bezel-set diamond accents add controlled sparkle for everyday outfits, workwear, dinners, and special occasions. The symbolic heart also makes it particularly suited to romantic gifting, birthdays, anniversaries, Valentine's gifting, or a meaningful present for someone close. With appropriate care, its smooth-setting design can transition comfortably between regular wear and occasion styling.

Product Information
SKU SHP-BRACELET111910844
Length 177.8 mm
Width 7.3 mm
Height 2 mm
Metal Weight 2.65 gm (Approximate)
Total Stone Weight 0.28 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.28 Carat (Approximate)
Dimension(approx) Round-3X3 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-bracelets

FAQs About: Bezel Set Diamond Heart Chain Bracelet

How many diamonds are in this bezel set diamond heart bracelet?

The bracelet contains two round brilliant-cut diamonds with a combined approximate weight of 0.28 carat. Each diamond measures approximately 3 x 3 mm and is secured in a bezel setting.

What diamond quality options are available for this heart chain bracelet?

The bracelet is offered with Lab (EF-VS) and Natural (HI-SI) gemstone quality selections, allowing you to choose between the available diamond options.

What is a bezel setting on a diamond bracelet?

A bezel setting surrounds the diamond with a smooth metal rim rather than holding it with exposed prongs. On this bracelet, the bezel setting gives the round diamonds a clean outline that complements the minimal chain and heart motif.

What does the heart design symbolize on this diamond bracelet?

The heart motif is widely associated with love, affection, care, and emotional connection. Paired with diamond accents, it makes the bracelet especially meaningful for anniversaries, birthdays, romantic gifting, friendship, or other relationship milestones.

What metal is the diamond heart chain bracelet made from?

The bracelet is crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K. It has an approximate metal weight of 2.65 grams and measures approximately 177.8 mm in length.

Does this diamond heart bracelet come with a Certificate of Authenticity?

Yes. Rosec Jewels offers a Certificate of Authenticity with the jewelry. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch for added purchase confidence.

How should I care for a bezel set diamond chain bracelet?

Keep the bracelet away from harsh chemicals and abrasive surfaces, clean it gently with a soft jewelry cloth, and store it separately when it is not being worn. Periodically checking the bezel settings and chain can also help maintain secure, comfortable regular wear.