Natural Diamond Star Pendant For Women

Sale price £399.00 Regular price £439.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Looking for something to embrace your personality then get this Diamond Star Pendant. It features a Diamond Studded Star motif, the diamonds are securely placed in prong setting. The pendant beholds the classic shine of HI-SI quality Real Diamond which makes the star motif shine like a real night star. This Celestial Necklace is precisely crafted to beautify your neckline and will be delivered to you in a premium quality box.

Product Information
SKU SHP-PENDANT122040424
Length 18.7 mm
Width 13.6 mm
Metal Weight 3.11 gm (Approximate)
Total Stone Weight 0.45 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 38 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-1 Pcs
Round-1.20X1.20 mm-28 Pcs
Round-1.30X1.30 mm-7 Pcs
Round-1X1 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-necklaces