Natural Diamond Two Heart Bracelet for Women

Sale price £635.00 Regular price £698.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Natural Diamond Two Heart Bracelet for Women

This natural diamond two heart bracelet is designed for women who appreciate jewelry with emotional meaning expressed through a refined, wearable form. The dual-heart motif represents connection and sentiment, making it suitable for personal wear or thoughtful gifting.

Its balanced design allows it to complement everyday outfits while remaining appropriate for special occasions, offering versatility without excess ornamentation.

Design & Setting

The two-heart design is intentionally composed to maintain visual harmony while keeping the diamonds as subtle focal points. The setting supports a lightweight and comfortable bracelet profile.

This structure allows the bracelet to sit naturally on the wrist, supporting consistent wear without overpowering the overall look.

Stone Value & Wearability

Set with natural diamonds, this bracelet is suitable for regular wear when handled with standard care. Its design prioritizes comfort and stability, making it practical for daily use.

High-Level Features

  • Two-heart bracelet design with natural diamonds
  • Balanced and lightweight construction
  • Designed for everyday and occasion wear
  • Symbolic style suitable for gifting
Product Information
SKU SHP-BRACELET0921397619
Width 15.5 mm
Height 2 mm
Metal Weight 4.00 gm (Approximate)
Total Stone Weight 0.63 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 52 Pieces
Total Weight 0.63 Carat (Approximate)
Dimension(approx) Round-1.60X1.60 mm-2 Pcs
Round-1.50X1.50 mm-4 Pcs
Round-1.30X1.30 mm-40 Pcs
Round-1.20X1.20 mm-3 Pcs
Round-1.10X1.10 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Surface-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-bracelets
Is this bracelet suitable for daily wear?
The bracelet can be worn daily depending on lifestyle and proper care.
What does the two heart design represent?
The two heart design commonly symbolizes connection, affection, and meaningful relationships.
Are the diamonds natural?
Diamond details and specifications are provided in the product information tables above.
Are metal options available?
Available metal options are listed in the existing product detail tables.
Is this bracelet sold as a single item?
This product is sold as a single bracelet unless otherwise specified in the product details.