Natural Emerald Diamond Heart Necklace for Women

Regular price £620.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

A mesmerizing blend of romance and elegance, this Heart Pendant Necklace is designed to capture attention in the most graceful way. At the top of the design rests a vibrant 5 mm Round Shape Emerald, glowing with a rich green hue that instantly draws the eye. From the Emerald, a Heart Shape motif flows downward, detailed with fine Beaded accents that add texture and charm. The Heart is beautifully encased with shimmering Diamond stones, creating a sparkling design that enhances its romantic appeal without overpowering the natural beauty of the emerald. This Emerald Diamond Necklace is perfect for women who love meaningful jewelry with a stylish twist. This Emerald Pendant Necklace adds a lovely touch to everyday outfits and pairs effortlessly with dresses for special occasions, date nights or celebrations. The thoughtful design blends classic symbolism with modern detailing, making this Emerald Necklace for Women both timeless and trendy. It arrives carefully placed in a jewelry box, ready for gifting on birthdays or anniversaries, or any heartfelt moment.

Product Information
SKU SHP-PENDANT082210292
Metal Weight 3.70 gm (Approximate)
Total Stone Weight 0.75 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-1 Pcs
Round-1.10X1.10 mm-15 Pcs
Round-1.20X1.20 mm-4 Pcs
Round-1X1 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
emerald-necklace