Natural Ethiopian Opal Floral Pendant Necklace with Diamond

Sale price £350.00 Regular price £393.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Bring expressive color and floral detail to the neckline with this natural Ethiopian opal pendant necklace with diamond accents. A round rainbow-hued opal forms the heart of the flower-inspired design, surrounded by sparkling diamonds that define its petal-like structure. The combination of shifting opal color and delicate diamond brilliance makes this pendant a thoughtful choice for birthdays, anniversaries, celebrations, and meaningful personal gifting.

Natural Ethiopian Opal Floral Pendant Necklace with Diamond Accents

The centerpiece is one approximately 0.51 carat natural Ethiopian opal measuring 5 x 5 mm. Round in shape with brilliant-cut faceting, AAA quality, rainbow color, and a prong setting, the opal remains clearly visible at the center of the floral motif. Twenty-eight round brilliant-cut diamonds surround the design, totaling approximately 0.26 carat with HI color and SI quality. The pendant has an approximate total stone weight of 0.77 carat and is crafted in 92.5 sterling silver with an approximate metal weight of 3.50 grams. It can be selected with an 18-inch chain or without a chain.

What Makes This Ethiopian Opal Floral Pendant Special

  • One natural Ethiopian opal weighing approximately 0.51 carat.
  • Round 5 x 5 mm center gemstone with brilliant cut and AAA quality.
  • Rainbow color play gives the opal a changing visual character as light moves across it.
  • 28 round brilliant-cut diamond accents totaling approximately 0.26 carat.
  • HI color and SI quality diamonds arranged within the flower-inspired setting.
  • Prong settings secure both the central opal and diamond accents.
  • Crafted in 92.5 sterling silver and selected yellow rose or white gold options in 10K, 14K, and 18K with an approximate metal weight of 3.50 grams.
  • Available with an 18-inch chain or as the pendant without a chain.

Why Choose an Ethiopian Opal Flower Pendant with Diamonds

The floral structure gives the pendant an organic, decorative silhouette while keeping the Ethiopian opal at the visual center. Its play-of-color brings changing flashes across the 5 mm gemstone, while the round diamonds introduce consistent brightness around it. The flower-inspired arrangement lends itself naturally to gifts that celebrate affection, growth, new chapters, and personal milestones, while the compact pendant format keeps the symbolism easy to wear rather than overly formal.

Natural Ethiopian Opal Craftsmanship & Authenticity

Rosec Jewels crafts this opal and diamond pendant with attention to gemstone placement, prong security, balanced floral detailing, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance supporting responsible long-term ownership.

Styling an Ethiopian Opal and Diamond Pendant Necklace

The round opal creates a colorful focal point at the center of the floral design, while the small diamonds add brightness around its edges without overwhelming the gemstone. With the 18-inch chain option, the pendant sits at an easy-to-style neckline length for dresses, blouses, knitwear, and open-neck tops. Its sterling silver setting also pairs naturally with silver-toned earrings or bracelets, making the necklace suitable for everyday styling with mindful care as well as birthdays, dinners, anniversaries, and other gifting occasions.

Product Information
SKU SHP-PENDANT032214548
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 0.77 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.51 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.26 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-4 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-8 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1X1 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
opal-necklaces

FAQs About: Natural Ethiopian Opal Floral Pendant Necklace with Diamond

What size and quality is the natural Ethiopian opal in this pendant?

The pendant features one natural Ethiopian opal measuring approximately 5 x 5 mm and weighing about 0.51 carat. It is round in shape, brilliant cut, rainbow in color, and graded AAA quality.

How many diamonds are in this Ethiopian opal floral necklace?

The floral design contains 28 round brilliant-cut diamonds with an approximate combined weight of 0.26 carat. The diamonds are graded HI color and SI quality and are arranged as accents around the opal-centered design.

What setting is used for the opal and diamond accents?

Both the round Ethiopian opal and the round diamond accents are secured in prong settings. The arrangement keeps the opal clearly visible at the center while the diamonds contribute sparkle throughout the flower-inspired framework.

What metal is used for this Ethiopian opal pendant necklace?

The confirmed pendant is crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 3.50 grams. The cool-toned silver provides a clean backdrop for the rainbow opal and white diamond accents.

Does the Ethiopian opal pendant come with a chain?

The pendant can be selected with an 18-inch chain or without a chain. This allows you to choose the complete necklace or pair the pendant with a compatible chain already in your jewelry collection.

Does this natural opal and diamond pendant come with a Certificate of Authenticity?

Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for an Ethiopian opal and diamond necklace?

Handle opal jewelry gently and protect it from scratches, strong impact, high heat, and sudden temperature changes. For cleaning, use warm soapy water and a soft cloth rather than ultrasonic or steam cleaning, and store the necklace separately from harder gemstones that could scratch the opal.