Nature Inspired 12 Carat Freshwater Pearl Drop Earrings

Regular price £443.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Indulge in a touch of natural elegance with these Pearl Drop Earrings, thoughtfully crafted to bring effortless beauty to any occasion. Each earring features a glowing 9X12 mm Freshwater Pearl Drop suspended from a uniquely shaped three petal flower, that feels both delicate and distinctive. One petal is gently adorned with petite Moissanite stones, adding a subtle sparkle that catches the light without overpowering the design. The combination of the floral motif and the radiant AAA Quality Pearl gives these Freshwater Cultured Pearl Earrings a graceful charm, perfect for brides-to-be, cocktail parties or anyone who loves jewelry with a fresh, nature-driven feel. The secure Screw Back Closure ensures all-day comfort and confidence, making them an easy choice for events, celebrations or elegant everyday wear. Presented in a beautifully designed jewelry box, they also make a thoughtful and memorable gift for someone special. With their blend of simplicity, shimmer and timeless appeal, these Flower Earrings are crafted to be adored and worn again and again.

Product Information
SKU SHP-EARRINGS012210280
Length 33 mm
Width 16 mm
Metal Weight 6.00 gm (Approximate)
Total Stone Weight 12.98 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 2 Pieces
Total Weight 12.00 Carat (Approximate)
Dimension(approx) Drops-9X12 mm-2 Pcs
Color White
Cut Brilliant
Shape Drops
Setting Type Bead-Set
Quality Grade AAA
MOISSANITE INFORMATION
No.of Stones 76 Pieces
Total Weight 0.98 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-16 Pcs
Round-1.20X1.20 mm-28 Pcs
Round-1.30X1.30 mm-22 Pcs
Round-1.50X1.50 mm-6 Pcs
Round-1X1 mm-4 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade D-VS1
View More

Product Parent Collection Handle
freshwater-pearl-earrings