Nature Inspired Citrine Flower Engagement Ring with Diamond

Regular price £347.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elevate your style with a ring that feels as alive and beautiful as the love it represents. This Flower Engagement Ring blooms with a radiant 5 mm Round Shape Citrine at its center, set in a delicate Flower motif that symbolizes growth, joy and new beginnings. The warm glow of the AAA Quality Citrine feels soft yet full of energy, drawing the eye and the heart instantly. Along the band, graceful leaf designs unfold, gently adorned with shimmering Diamond stones that catch the light like morning dew. Every detail is thoughtfully crafted to reflect harmony, romance, and a deep connection to nature. The design feels whimsical yet elegant, perfect for someone who loves meaningful beauty with a touch of individuality. Comfortable for everyday wear, this Citrine Engagement Ring is made to move with her and become part of her story. This Citrine Diamond Ring arrives in a signature jewelry box, ready to make the moment unforgettable from the very first glance.

Product Information
SKU SHP-RINGS0821187350
Width 6 mm
Height 8 mm
Metal Weight 3.60 gm (Approximate)
Center Stone Weight 0.51 Carat (Approximate)
CITRINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.51 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Yellow
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
citrine-engagement-rings