Nature Inspired Tanzanite Engagement Ring with Diamond

Sale price £330.00 Regular price £371.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

On your special day, let your love bloom with a ring that feels as natural and rare as the bond you share. This Flower Engagement Ring is designed to tell a story of romance, growth and forever. At the center of the delicate Flower motif is a 5 mm Round Shape Tanzanite set in Prong Setting, glowing with soft blue hues that capture emotion, depth and devotion. Like a promise, Diamond stones shimmer along the band, reflecting light with every movement and adding a gentle sparkle that feels both elegant and alive. The flowing details of the band are inspired by the beauty of nature, creating a design that feels graceful and timeless. Every curve is thoughtfully crafted to symbolize love that grows stronger with time. Presented in a signature jewelry box, this Tanzanite Engagement Ring becomes more than a gift, it becomes a moment and a promise. Available in a range of ring sizes, this Tanzanite Diamond Ring is made to fit perfectly, just like the love it represents. Whether you are beginning a new chapter or celebrating a lifelong journey, this Blue Tanzanite Ring speaks softly yet deeply, expressing eternal love most beautifully.

Product Information
SKU SHP-RINGS0821187972
Width 6 mm
Height 8 mm
Metal Weight 3.60 gm (Approximate)
Center Stone Weight 0.54 Carat (Approximate)
TANZANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.54 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
tanzanite-engagement-rings