Oval Cut Certified Ethiopian Opal Vintage Inspired Engagement Ring with Diamond

Sale price £300.00 Regular price £337.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Timeless romance blends beautifully with modern elegance in this Vintage Style Engagement Ring, thoughtfully designed to celebrate love and cherished memories. At the heart of this stunning piece lies a 5X7MM oval cut ethiopian opal, known for its rainbow hue. Set in claw setting, the diamond is accentuated by smaller diamond stones on a filigree motif, creating a art deco-inspired design that adds a touch of vintage charm and feminine grace. This vintage design in this Opal Engagement Ring not only enhances the overall appeal but also offers more coverage on the finger, making it a flattering choice for everyday wear. Available in various precious metal options, this Natural Ethiopian Opal Ring for Women is suitable for a wide range of budgets and personal styles. Whether you are marking a wedding, anniversary, birthday, or any special occasion, this handcrafted Vintage Ring makes a meaningful and memorable gift. Expertly made by Rosec Jewels skilled artisans, it is a lovely way to celebrate the special woman in your life with a ring that combines tradition, artistry, and modern values.

Product Information
SKU SHP-RINGS032223193
Metal Weight 3.60 gm (Approximate)
Center Stone Weight 0.90 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Oval-5X7 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 4 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-1.80X1.80 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
opal-rings