Real Aquamarine Infinity Stud Earrings

Sale price £246.00 Regular price £277.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Commemorate a meaningful promise with this elegant pair of Infinity Stud Earrings, thoughtfully designed to symbolize everlasting love and connection. Each earring features two radiant round shape aquamarine gemstones, carefully set in secure prong setting and gracefully held within a beautifully crafted infinity motif. The infinity design represents continuity, devotion, and an unbreakable bond, making these Aquamarine Stud Earrings a deeply symbolic choice for a promise day or any occasion that celebrates commitment. Crafted with AAA quality real aquamarine, these gemstones display a blue hue and exceptional clarity, reflecting sophistication and timeless beauty. Aquamarine, known as the March birthstone, adds further significance, symbolizing calmness, harmony, and lasting affection. The Two Stone Earrings are designed with screw back closures to provide a secure and comfortable fit, ensuring confidence throughout the day. Expert craftsmanship ensures durability, allowing these March Birthstone Earrings to maintain their beauty over time. Their graceful design makes them suitable for both daily wear and special moments, offering versatility while preserving elegance. Presented in a premium jewelry box and accompanied by a certificate of authenticity, this pair is ready to be gifted and cherished.

Product Information
SKU SHP-EARRINGS042158007
Metal Weight 1.80 gm (Approximate)
Total Stone Weight 1.00 Carat (Approximate)
AQUAMARINE INFORMATION
No.of Stones 4 Pieces
Total Weight 1.00 Carat (Approximate)
Dimension(approx) Round-4X4 mm-4 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
aquamarine-earrings