Real Blue Sapphire and Diamond Evil Eye Hoop Drop Earrings

Regular price £1,426.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bold style meets meaningful design in these stunning Evil Eye Earrings. Created to stand out, each earring features a classic evil eye motif with a striking round shape blue sapphire at its center. The sapphire is securely set in bezel setting, giving it a beautiful shine. Surrounding the center stone is an eternity-style outline lined with sparkling diamond stones. This detailed setting enhances the protective and symbolic feel of the evil eye design while adding a luxurious touch. The beauty doesnt stop there. The hinged hoop is also decorated with dainty diamonds, giving the Hoop Drop Earrings extra sparkle from top to bottom. The hoop design makes them easy to wear and secure, while the drop style adds graceful movement that catches the light with every step. Crafted in hallmarked metal, these Blue Sapphire Hoop Earrings offer both quality and durability. The certified metal ensures lasting shine and strength, making them a reliable addition to your jewelry collection. Perfect for day or night, these Sapphire and Diamond Earrings bring together symbolism, elegance, and bold sparkle.

Product Information
SKU SHP-EARRINGS052174828
Metal Weight 4.60 gm (Approximate)
Total Stone Weight 1.50 Carat (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-4X4 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 86 Pieces
Total Weight 0.70 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-26 Pcs
Round-1X1 mm-60 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade SI
View More

Product Parent Collection Handle
blue-sapphire-earrings