Real Diamond Flower Crawler Earring for Helix Piercing

Regular price £565.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by natures beauty, this Diamond Flower Crawler Earring is embellished with baguette, marquise, and round shape diamonds studded on the floral motif.

  • You can wear this diamond climber earring on your helix, cartilage, or upper lobe piercing. The flat back closure will keep it secured in place.
  • Elevate your ear stack with the flower cartilage earring, youre sure to shine. You can simply pair it with studs and huggie hoops.
  • Present this Diamond Floral Earring to your special one, as a birthday gift, anniversary gift, graduation gift, or bridesmaid gift. Perfect for any occasion!
Product Information
SKU SHP-BODYJ082410087
Length 13 mm
Width 6.8 mm
Height 2.2 mm
Metal Weight 1.30 gm (Approximate)
Total Stone Weight 0.22 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Baguette-1.50X3.00 mm-1 Pcs
Marquise-1.50X3.00 mm-2 Pcs
Round-1.50X1.50 mm-2 Pcs
Color HI
Cut Brilliant
Shape Baguette, Marquise, Round
Setting Type Prong-Setting
Quality Grade SI
View More