Real Freshwater Pearl and Diamond Minimal Drop Earrings

Sale price £430.00 Regular price £483.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

These drop earrings feature a classic round freshwater pearl topped with a metal motif that is designed in the shape of a petal. Gleaming round Diamond is embedded within the metal frame for an added allure. The pearl fascinates with its lustrous white hue and sits harmoniously with the Diamond that shines brilliantly. Having screw back posts, the earring pair exudes an undeniable beauty.

Product Information
SKU SHP-EARRINGS0921397802
Metal Weight 1.70 gm (Approximate)
Total Stone Weight 15.37 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 2 Pieces
Total Weight 14.96 Carat (Approximate)
Dimension(approx) Round-8X8 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 20 Pieces
Total Weight 0.41 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-4 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.50X1.50 mm-14 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
freshwater-pearl-earrings