Real Oval Ethiopian Opal Diamond Flower Engagement Ring with Split Shank

Sale price £324.00 Regular price £364.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Create a fairy tale moment with this Flower Engagement Ring, a piece that captures the magic of love in full bloom. At its center glows an ethereal 5X7 mm Oval Shape Ethiopian Opal set in Prong Setting, surrounded by sparkling Diamond petals. The Split Shank band gracefully wraps around the finger, symbolizing two lives intertwining into one beautiful journey. The Oval Shape of the Opal, paired with the floral motif, creates a soft, romantic design that instantly enhances the elegance of the hand. The Split Shank design adds a touch of modern artistry while making the finger appear longer and more slender. This Opal Diamond Engagement Ring is a symbol of love that grows and blossoms with time. Thoughtfully crafted and presented in a signature jewelry box, this Split Shank Engagement Ring with Opal comes in a range of sizes for a perfect fit. Whether you are proposing or celebrating a once-in-a-lifetime moment, this Opal Flower Ring with Engagement is a radiant promise of forever.

Product Information
SKU SHP-RINGS082224040
Metal Weight 2.70 gm (Approximate)
Center Stone Weight 0.90 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Oval-5X7 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 30 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-12 Pcs
Round-1.10X1.10 mm-6 Pcs
Round-1X1 mm-12 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
opal-rings