Round Diamond Devil Heart Earrings

Regular price £245.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

As a striking fusion of edgy design and timeless luxury, these Diamond Stud Earrings are imbued with a subtle and alluring twist that hints at a rebellious spirit. Radiating an unparalleled sparkle, these Stud Earrings are adorned with Round Shape Diamond in Pave Setting, on the open heart frame. The cute devil horn completes the look with the eye-catching design. These unique Devil Horn Earrings reimagine the classic heart motif with a captivating, slightly off-kilter design, hinting at a beautifully defiant spirit. Wear them as a symbol of your bold individuality, a luxurious whisper of rebellion that adds a dynamic shimmer to your everyday style or evening attire. These Devil Heart Earrings have the ultimate combination of HI-SI Quality Diamond and a devilish design that creates a unique visual appeal, which might be interpreted as rebellious, edgy, or even a playful expression of individuality. A unique gift for someone who appreciates unconventional jewelry.

Product Information
SKU SHP-EARRINGS022150364
Length 12 mm
Width 14.7 mm
Metal Weight 2.00 gm (Approximate)
Total Stone Weight 0.31 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 52 Pieces
Total Weight 0.31 Carat (Approximate)
Dimension(approx) Round-1X1 mm-52 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
april-birthstone-jewelry