Round Moissanite Flower Cartilage Earring

Sale price £259.00 Regular price £297.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Express your love with this exquisite Helix Earring, adorned with Round Cut Moissanites in Prong Setting to create an irresistible look. Its Flat Back closure ensures that it stays securely in place, making it suitable for Rook, Tragus, Conch, Cartilage, Helix, or Lobe piercings. This Flower Earring adds a flawless charm to your appearance that is hard to resist. With its enduring beauty and outstanding quality, this earring is ideal for any event. Its lightweight design and snug fit make it suitable for daily wear as well as special occasions. Shimmering moissanite stones provide a lavish sparkle that instantly elevates your look. The floral motif adds a romantic touch, while the classic stud style introduces a fashionable element. Whether given as a considerate gift or worn as a cherished accessory, the Moissanite Cartilage Earring combines beauty, brilliance, and comfort in a delightful piece of jewelry.

Product Information
SKU SHP-BODYJ012210347
Metal Weight 0.50 gm (Approximate)
Total Stone Weight 0.18 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 3 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-2X2 mm-3 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
helix-earrings