Round Moissanite Flower Proposal Ring in Bypass Shank

Sale price £216.00 Regular price £248.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Round Moissanite Flower Proposal Ring in Bypass Shank is designed for those who want their proposal to feel expressive and distinctive. The round moissanite center stone forms the heart of a floral-inspired setting, creating a soft yet radiant focal point. Its elegant composition makes it a meaningful engagement ring choice for those drawn to romantic detail and refined brilliance.

Bypass Shank with Sculpted Movement

The bypass shank curves gracefully around the center, adding fluidity and dimension to the design. This structure creates a sense of motion while naturally drawing attention to the flower-inspired centerpiece. The thoughtful arrangement balances delicacy with visual presence, resulting in a ring that feels artistic yet wearable.

Moissanite with Modern Origin

Moissanite is admired for its exceptional brilliance and fire, offering a bright, lively appearance. Created without traditional mining, it provides an alternative sourcing method, though impact varies by production and energy source. With proper care, moissanite is suitable for regular wear, making it a practical and radiant choice for an engagement ring.

Designed for Meaningful Commitment

The combination of a floral motif and bypass structure gives this proposal ring a distinctive silhouette that stands apart from classic solitaire styles. It can be worn alone as a statement of commitment or paired with complementary bands for a coordinated bridal look. The overall design emphasizes balance, movement, and enduring symbolism.

Product Information
SKU SHP-RINGS082220208
Width 4.5 mm
Height 8.5 mm
Metal Weight 3.80 gm (Approximate)
Total Stone Weight 0.66 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 7 Pieces
Total Weight 0.66 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Round-2.50X2.50 mm-6 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
graduation-gifts

FAQs About: Round Moissanite Flower Proposal Ring in Bypass Shank

Is moissanite suitable for an engagement ring?
Yes. Moissanite is valued for its durability and brilliance, making it a practical and radiant choice for everyday engagement ring wear with proper care.
What does a bypass shank design offer?
A bypass shank curves around the center stone, adding movement and visual interest while drawing attention toward the focal point.
Is a flower-style setting considered timeless?
Floral-inspired settings have long been associated with romance and symbolism, making them a classic yet expressive engagement ring option.
Can this ring be worn daily?
With mindful care, this ring can be worn daily. Removing it during heavy impact activities helps maintain the condition of the gemstone and metal.
How should I clean this moissanite proposal ring?
Clean gently using mild soap, lukewarm water, and a soft cloth. Avoid harsh chemicals and store separately to help preserve the ring’s finish and brilliance.