Round Pink Tourmaline Flower Stud Earrings with Diamond

Regular price £320.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Significant occasions deserve jewelry that feels extraordinary, and these Flower Stud Earrings are prepared to dazzle alongside you. Each earring showcases a round pink tourmaline set in a prong setting. Encircling the central stone, flower petals adorned with shimmering diamonds enhance depth and brilliance, giving the Flower Stud Earrings a striking yet elegant presence. The floral motif exudes a romantic vibe that is perfect for weddings, evening gatherings, and celebrations where you wish your jewelry to be the center of attention. Made with AAA quality pink tourmaline and HI-SI quality diamonds, these Pink Tourmaline Stud Earrings promise enduring beauty and exceptional craftsmanship. The secure screw-back closures provide a comfortable and dependable fit, making them ideal for extended wear during special events. Whether as wedding stud earrings or a heartfelt gift, these floral studs complement bridal gowns, cocktail dresses, and sophisticated evening attire effortlessly. The blush pink hue of the tourmalines adds a splash of color, while the diamonds contribute timeless brilliance. Thoughtfully presented, these Tourmaline and Diamond Earrings become a classic addition to any jewelry collection, offering charm, sparkle, and a hint of romance that is sure to be appreciated.

Product Information
SKU SHP-EARRINGS052174817
Length 10.6 mm
Width 10.6 mm
Metal Weight 2.44 gm (Approximate)
Total Stone Weight 0.35 Carat (Approximate)
PINK TOURMALINE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-3X3 mm-2 Pcs
Color Pink
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 42 Pieces
Total Weight 0.17 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-28 Pcs
Round-0.90X0.90 mm-14 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
tourmaline-earrings