Simple Moissanite Flower Pendant with Halo

Sale price £217.00 Regular price £250.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This pendant features a floral-inspired design centered around moissanite gemstones arranged in a flower shape. The surrounding halo enhances the sparkle of the centerpiece, creating a balanced composition of brilliance and decorative detail.

The floral motif adds a graceful element to the design, while the halo accent contributes additional light reflection around the central stones.

Floral Pendant Design

Flower-inspired jewelry designs are often chosen for their elegant and symbolic appearance. The petal-like arrangement of gemstones creates a shape that resembles a blooming flower, offering a soft and refined visual aesthetic.

This design style highlights symmetry and detail, making floral pendants a distinctive choice in gemstone jewelry.

Moissanite Gemstones

Moissanite is recognized for its strong brilliance and light dispersion, allowing it to produce noticeable sparkle when exposed to light. These optical properties make it a distinctive gemstone in pendant designs.

Moissanite gemstones are created without traditional mining, though environmental impact can vary depending on production processes and energy sources.

Halo Setting Detail

Halo settings surround the central design with additional small gemstones that enhance the overall brilliance of the piece. This structure frames the centerpiece while adding extra sparkle to the pendant.

The halo arrangement draws attention to the floral motif and emphasizes the layered gemstone design.

Elegant Gemstone Necklace Style

Pendant necklaces that combine gemstone brilliance with decorative motifs create a visually balanced jewelry piece. The floral structure and halo accent work together to produce a design that reflects both elegance and distinctive craftsmanship.

This arrangement highlights gemstone sparkle while maintaining a refined and symmetrical pendant style.

Product Information
SKU SHP-PENDANT072210034
Length 19.3 mm
Width 13.2 mm
Height 3.6 mm
Metal Weight 3.30 gm (Approximate)
Total Stone Weight 1.73 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 33 Pieces
Total Weight 1.73 Carat (Approximate)
Dimension(approx) Round-4X4 mm-4 Pcs
Round-2X2 mm-1 Pcs
Round-1.20X1.20 mm-28 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs About: Simple Moissanite Flower Pendant with Halo

What is a halo pendant?
A halo pendant features a central gemstone or design surrounded by smaller stones that enhance the overall sparkle and frame the centerpiece.
What is moissanite?
Moissanite is a gemstone known for its strong brilliance and light dispersion, which create noticeable sparkle in jewelry.
Why are floral designs used in jewelry?
Floral designs are commonly used in jewelry because they symbolize beauty and nature while offering an elegant decorative motif.
What does a halo setting do for a gemstone design?
A halo setting surrounds the center design with smaller stones that increase brightness and draw attention to the centerpiece.
Are gemstone pendants suitable for everyday wear?
Gemstone pendants are often worn as everyday jewelry because they provide decorative sparkle while remaining versatile for different styles.
What makes moissanite visually distinctive?
Moissanite reflects light strongly due to its optical properties, producing bright sparkle and noticeable brilliance in jewelry pieces.