Unique Freshwater Pearl Star Helix Earring with Diamond

Regular price £344.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Crafted with care, this Star Helix Earring boasts a beautiful design featuring a Round Freshwater Pearl and Round Cut Diamond arranged over a star motif in Gold Metal. This Star Earring is versatile and suitable for Rook, Cartilage, or Upper Lobe Piercings, with the option of Flat Back or Ball Screw Back Closures. Perfect for any casual or special occasion, this Celestial Earring also makes an ideal gift to impress your loved one.

Product Information
SKU SHP-BODYJ082210031
Metal Weight 0.60 gm (Approximate)
Total Stone Weight 0.19 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.16 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.03 Carat (Approximate)
Dimension(approx) Round-1X1 mm-5 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
helix-earrings