Vintage Looking Ethiopian Opal Flower Engagement Ring with Diamond

Regular price £391.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Vintage-Inspired Ring with Floral Character

This vintage-looking Ethiopian opal flower engagement ring is designed for those drawn to intricate detail and romantic symbolism. At its center, a natural Ethiopian opal displays shifting flashes of color, surrounded by a floral-inspired diamond arrangement that enhances its glow.

The design captures heirloom influence while maintaining a refined, wearable profile suited to modern bridal style.

Floral Motif and Diamond Accents

The flower-inspired setting frames the opal in a petal-like arrangement, giving the ring soft structure and visual dimension. Diamond accents introduce contrast and brilliance, highlighting the opal’s natural play-of-color without overwhelming its individuality.

Vintage detailing lends texture and depth, reinforcing the antique aesthetic that defines this piece.

Natural Ethiopian Opal Qualities

Ethiopian opal is valued for its vibrant internal color patterns, which can shift depending on light and angle. Because it is a softer gemstone than traditional engagement stones, it benefits from attentive wear and mindful storage.

Understanding its characteristics ensures long-term appreciation of its luminous beauty.

High-Level Features

This engagement ring combines a natural Ethiopian opal center with diamond accents in a vintage-inspired floral setting. The composition emphasizes color expression, intricate craftsmanship, and romantic symbolism.

Product Information
SKU SHP-RINGS042210249
Metal Weight 3.20 gm (Approximate)
Center Stone Weight 0.80 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 22 Pieces
Total Weight 0.21 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-12 Pcs
Round-1X1 mm-10 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
opal-rings

FAQs About: Vintage Ethiopian Opal Flower Engagement Ring With Diamond

What makes this opal engagement ring look vintage?
The floral-inspired design, detailed setting work, and diamond accents create an antique aesthetic reminiscent of heirloom jewelry.
Is Ethiopian opal suitable for everyday engagement wear?
Ethiopian opal can be worn daily with care, but it is softer than many traditional engagement stones and should be handled thoughtfully.
How do the diamonds enhance the opal center?
The diamond accents provide structured sparkle that frames the opal, helping its color flashes stand out more clearly.
How should I clean a vintage-style opal ring?
Use a soft damp cloth and avoid harsh chemicals or ultrasonic cleaning. Gentle care helps maintain the opal’s surface and setting details.
Who is this floral opal engagement ring best suited for?
It is ideal for someone who appreciates romantic, nature-inspired design and prefers a distinctive gemstone over a traditional clear center stone.