Vintage Style Diamond Key Necklace For Women

Regular price £259.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

As an everyday reminder of your bond, this Diamond Key Necklace symbolises trust and commitment. A meaningful addition to the jewelry collection, this Key Heart Necklace has a minimalist design, reflecting your classy touch. Speaking of vibes and a romantic flair, this pendant is adorned with Round Shape Diamond studded on the heart-shaped design and on the key. Dangling through a chain, this Key To My Heart Necklace is a timeless expression of romantic love that beautifully embodies a commitment and the shared journey between two individuals. This Pendant symbolises unlocking all the love in her heart. Embodying boldly, this Diamond Necklace is an iconic motif that makes it a great design with ornate details. As a powerful symbol of love, affection, and commitment, it represents the idea of unlocking someones heart or holding the key to their love and affection. This Key in Heart Necklace is a popular present for special occasions like Valentines Day or anniversaries.

Product Information
SKU SHP-PENDANT092020674
Length 37 mm
Width 9.9 mm
Metal Weight 4.00 gm (Approximate)
Total Stone Weight 0.13 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 29 Pieces
Total Weight 0.13 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-14 Pcs
Round-0.90X0.90 mm-12 Pcs
Round-1.30X1.30 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
key-necklaces