Womens Lab Grown Black and White Diamond Solitaire Star Drop Necklace

Regular price £271.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Transform your style into a statement with this Solitaire Pendant, exquisitely crafted by Rosec Jewels. Designed to enchant, the pendant features a breathtaking 8 mm round cut lab-grown black diamond of AAAA quality, elegantly positioned at the heart of a graceful teardrop frame. A delicate star motif introduces a celestial element, evoking the allure and mystery of the night sky, while enhancing the pendant’s modern yet timeless charm. Suspended from a refined cable chain, this Drop pendant gracefully dangles to highlight the neckline with effortless sophistication. The clean lines, brilliant sparkle, and meticulous detailing showcase exceptional craftsmanship, making it a remarkable piece that harmonizes sophistication with everyday wearability. Created to convey individuality and refined taste, this solitaire drop pendant acts as a versatile statement accessory. Whether worn as a daily signature piece or styled to enhance evening attire, it imparts a subtle brilliance that elevates any ensemble. Ideal for special occasions such as anniversaries, engagements, weddings, birthdays, cocktail parties, and festive gatherings, this lab created black diamond necklace transitions effortlessly from day to night. Its celestial-inspired design also renders it a perfect choice for romantic evenings and unforgettable moments. A meaningful and luxurious gift, this Rosec Jewels diamond pendant necklace is perfect for Valentine’s Day, anniversaries, milestone achievements, graduations, or simply to celebrate love and success. With its radiant lab-grown diamond, celestial detailing, and elegant teardrop silhouette, this created black diamond necklace is a timeless addition to any fine jewelry collection, designed to shine as brightly as the moments it signifies.

Product Information
SKU SHP-PENDANT122310130
Metal Weight 4.10 gm (Approximate)
Total Stone Weight 2.20 Carat (Approximate)
SYNTHETIC BLACK DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 2.16 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA ( Synthetic )
LAB GROWN DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.04 Carat (Approximate)
Dimension(approx) Round-2.10X2.10 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More