Womens Moissanite Flower Engagement Ring with Certificate

Regular price £278.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Expression of Commitment

The Women’s Moissanite Flower Engagement Ring with Certificate is designed for those who appreciate symbolism in fine jewelry. Inspired by the natural form of a blooming flower, this ring represents growth, beauty, and enduring love.

Its balanced silhouette makes it suitable for everyday wear while offering distinctive detail that sets it apart from traditional solitaire styles.

Floral Setting with Structured Detail

The flower-inspired arrangement frames the center stone with carefully placed accents, creating dimension and visual depth. This structured setting allows light to interact from multiple angles, enhancing overall brilliance without overwhelming the design.

The ring is crafted to maintain both decorative appeal and stability, ensuring the floral motif remains defined and secure over time.

Certified Moissanite Brilliance

Moissanite is selected for its durability and strong light performance, making it well-suited for engagement jewelry worn regularly. Created without traditional mining, moissanite offers an alternative to earth-mined stones, though impact varies by production and energy source.

Certification accompanies the stone as detailed in the product specification tables, offering documented quality assurance.

High-Level Features

  • Flower-inspired engagement ring design.
  • Certified moissanite center and accent detailing.
  • Balanced structure for everyday comfort.
  • Available in the metal options listed in the product detail tables.
Product Information
SKU SHP-RINGS082214539
Metal Weight 3.22 gm (Approximate)
Total Stone Weight 1.58 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 13 Pieces
Total Weight 1.58 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Pear-3X5 mm-6 Pcs
Princess Cut-2X2 mm-6 Pcs
Color White
Cut Brilliant
Shape Round, Pear, Princess Cut
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings

FAQs about: Women’s Moissanite Flower Engagement Ring with Certificate

Is this flower engagement ring suitable for daily wear?
Yes. Moissanite is known for its durability, and the structured floral setting is designed to support regular wear with proper care.
Does this ring come with a certificate?
The moissanite featured in this ring is certified, as specified in the product detail tables, providing documented quality information.
What makes a floral engagement ring different from a classic solitaire?
A floral engagement ring incorporates petal-inspired design elements around the center stone, adding decorative detail and dimension compared to a traditional single-stone setting.
How should I care for this moissanite engagement ring?
Clean gently with warm water, mild soap, and a soft brush. Store separately to help prevent scratches and avoid exposure to harsh chemicals.
Is this ring appropriate for proposals?
The floral design and certified stone make it suitable for proposals, particularly for those seeking a distinctive alternative to traditional engagement ring styles.