Black Spinel and Diamond Half Eternity Ring in Prong Setting

0
Regular price £965.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

The Black Spinel and Diamond Half Eternity Ring in Prong Setting is made for someone who loves contrast, meaning, and a confident jewelry statement. Three round black spinel stones bring a bold center rhythm to the band, while four round diamonds add bright sparkle between the darker gemstones.

Designed as a half eternity beaded stackable ring, this piece carries the feeling of a continuing promise while keeping the underside comfortable for everyday wear. It is a distinctive choice for an anniversary, promise gift, stacking band, self-purchase milestone, or a meaningful ring with a modern black-and-white gemstone story.

Round Black Spinel and Diamond Half Eternity Ring

This half eternity ring features three round brilliant cut black spinel stones in AAA quality with an approximate total weight of 0.27 carat, paired with four round brilliant cut diamonds in HI-SI quality with an approximate total weight of 0.36 carat. Each stone is secured in a prong setting, and the ring has an approximate weight of 2.32 GM. Available metal options include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

What Makes This Special

The ring combines black spinel and diamond in a half eternity layout, creating a striking contrast of deep black color and bright white sparkle. The alternating gemstone feel gives the band more personality than a plain stackable ring.

The black spinel stones measure approximately 3X3 MM each and are round brilliant cut to support a polished, light-catching surface. Their AAA quality grade adds to the ring’s refined gemstone appeal.

The design also includes four round brilliant cut diamonds measuring approximately 2.40X2.40 MM each. Their HI color and SI quality add a bright accent beside the black spinel, while prong settings keep the gemstones defined and open to light.

Why Choose This Design

A half eternity ring offers the emotional symbolism of a continuous gemstone band while keeping the lower part of the ring more practical for wear. This makes it a thoughtful choice for those who want meaning, comfort, and stackable styling in one design.

The black spinel gives the ring a bold visual identity, while the diamonds soften the look with refined sparkle. The prong setting allows each round stone to stand clearly on the band, helping the black and white gemstone contrast become the main design feature.

Design Meaning

The half eternity layout represents lasting affection, shared memories, and a bond that continues forward. It is especially meaningful for anniversary gifts, promise rings, or personal milestones that deserve a piece with emotional depth.

Black spinel adds a sense of strength, individuality, and quiet confidence, while diamonds bring brightness and celebration. Together, the two gemstones create a design that can symbolize balance: depth and light, resilience and joy, commitment and personal style.

Authenticity & Craftsmanship

This ring is crafted with three AAA quality black spinel stones and four HI-SI quality diamonds, all in round brilliant cuts and prong settings. The product specifications include an approximate total black spinel weight of 0.27 carat, an approximate total diamond weight of 0.36 carat, and an approximate ring weight of 2.32 GM.

Rosec Jewels’ shop-with-confidence details include certified jewelry, precious metal only, checked by hand, free and insured shipping, and 30 days free return. To care for this ring, clean it gently with mild soapy water and a soft brush, avoid harsh chemicals, and store it separately when not worn.

Style and Wearability

From the top, the ring shows a refined sequence of round black spinel and diamonds across the band, giving it a strong yet wearable look. The beaded stackable design makes it easy to wear alone as a meaningful accent or pair with other bands for a layered jewelry style.

Its black-and-white gemstone contrast works well with both everyday outfits and evening looks. The available metal options allow the wearer to choose a cool white finish or a warm yellow gold tone to match their personal style and existing jewelry.

Product Information
SKU SHP-RINGS032225893
Weight 2.32 gm (Approximate)
BLACK SPINEL INFORMATION
No.of Stones 3 Pieces
Total Weight 0.27 Carat (Approximate)
Dimension(approx) Round-3X3 mm-3 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 4 Pieces
Total Weight 0.36 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
black-spinel-rings

FAQs About: Black Spinel and Diamond Half Eternity Ring in Prong Setting

What makes this black spinel and diamond ring special?

This ring is special because it pairs three round black spinel stones with four round diamonds in a half eternity beaded stackable design. The black gemstones create bold contrast, while the diamonds add bright sparkle across the band.

What gemstones are used in this half eternity ring?

The ring features three round brilliant cut black spinel stones and four round brilliant cut diamonds. The black spinel has an approximate total weight of 0.27 carat, and the diamonds have an approximate total weight of 0.36 carat.

What setting style does this ring have?

This ring uses prong settings for both the black spinel stones and the diamonds. The prong setting helps keep each round stone defined while allowing light to reach the gemstones.

Is this ring a full eternity or half eternity design?

This is a half eternity ring. The gemstone detail is placed across the upper portion of the band, giving the ring a meaningful eternity-inspired look while keeping it practical for stacking and regular wear.

What metal options are available for this ring?

The available metal options include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Is this black spinel and diamond ring certified or authenticated?

Rosec Jewels’ shop-with-confidence details include certified jewelry, precious metal only, and checked by hand. The product specifications AAA quality black spinel and HI-SI quality diamonds.

How should I care for this black spinel and diamond ring?

Clean the ring gently with mild soapy water, a soft brush, and a lint-free cloth. Avoid harsh chemicals, remove it before heavy work, and store it separately to help protect the black spinel, diamonds, prong settings, and metal finish.