Certified 0.8 Carat Lab Grown Black and White Diamond Flower Engagement Ring

Regular price £1,037.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the beauty of nature, this Flower Engagement Ring tells a love story that is both rare and meaningful. At its center sits a striking 5 mm Round Shape Synthetic Black Diamond set in Prong Setting in a flower motif that represents growth, new beginnings and a bond that continues to bloom over time. The contrast of the deep black center with the shimmering white diamond stones along the band creates a look that is bold yet graceful, symbolizing the balance of strength and purity in a relationship. The nature-inspired detailing adds an organic charm, making the Lab Grown Black Diamond Engagement Ring stand out while still staying timeless. This Black and White Diamond Ring reflects a promise of loyalty, passion and a journey shared together. This Nature Inspired Engagement Ring is a beautiful choice for someone who appreciates uniqueness and meaning in every detail. Presented in a signature jewelry box and available in a range of ring sizes, this Lab Grown Black Diamond Ring for Women is ready to become part of your special moment. Perfect as an engagement ring or a heartfelt expression of forever, it captures the essence of love that grows stronger with every passing day.

Product Information
SKU SHP-RINGS0821187964
Width 6 mm
Height 8 mm
Metal Weight 3.83 gm (Approximate)
Center Stone Weight 0.84 Carat (Approximate)
SYNTHETIC BLACK DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.84 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA ( Synthetic )
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-black-diamond-engagement-rings