Certified Diamond Flower Stud Earrings in Prong Setting

Regular price £557.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elevate your everyday style with these exquisite Diamond Flower Earrings that effortlessly combine the timeless beauty of a delicate floral design with a modern and minimalist aesthetic. Crafted with meticulous attention to detail, these Earrings are adorned with Round Shape Diamond in Prong Setting, mimicking the floral design, with a subtle spark and adding a connection to nature to your look. The understated beauty of these Minimalist Earrings is a timeless motif that evokes innocence, joy, and new beginnings. Offering a subtle sparkle that draws attention without overpowering your look, these Floral Earrings appreciate a touch of natural charm blended with modern design. It draws attention without overpowering your look by adding a touch of refined elegance. These minimal Nature Inspired Earrings are a meaningful expression of affection and also makes an ideal gift for birthdays or just because, that beautifully symbolizes hope and faith. A perfect jewelry addition to your collection to wear as an everyday staple.

Product Information
SKU SHP-EARRINGS082210049
Metal Weight 1.60 gm (Approximate)
Total Stone Weight 0.90 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-10 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stud-earrings