Certified Diamond Infinity Band Ring

Regular price £765.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

The vows and commitment are made to be beautiful with this Diamond Infinity Ring. Its sleek design and Diamond studded on Infinity pattern of this Half Eternity Ring is an exquisite band that would make a perfect one for a wedding. Sparkling with every moment, the infinity motif represents a never-ending bond, making it the perfect choice for expressing your promises and devotion. Create a harmonious blend of modern glamour and classic charm, with this Infinity Wedding Ring is great to mark a significant event and also an unwavering devotion. This Classy Infinity Sign Ring produces the fire and sparkle, boasting a similar aesthetic. Expressing undying love, it tends to be a symbol of never-ending love and affection. The beautiful combination of the Diamond Infinity Band symbolizes on and on forever. Incorporating the infinity sign has unique twists that expand halfway down the band. The appealing look of the Diamond Eternity Ring adds a touch of style and symbolism to your ring stack. It fits perfectly with your lifestyle and will withstand daily wear.

Product Information
SKU SHP-RINGS052210335
Metal Weight 1.68 gm (Approximate)
Total Stone Weight 0.34 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 21 Pieces
Total Weight 0.34 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-6 Pcs
Round-1.20X1.20 mm-6 Pcs
Round-1.50X1.50 mm-6 Pcs
Round-1.60X1.60 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-rings