Certified Lab Created Ruby Half Eternity Infinity Ring with Diamond

Regular price £1,099.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make her feel special with this Half Eternity Band Ring, a stunning expression of love that is as timeless as it is elegant. This Fine Ring features 4 mm Round Shape Lab Created Ruby stones, cradled in the center of infinity knots across half of the band, symbolizing endless love and connection. Surrounding the knot, sparkling Diamond stones trace the curve of the band, adding a touch of brilliance that catches the light from every angle. The half eternity design wraps gracefully around the finger, offering just the right balance of sparkle and sophistication, while the Infinity Motif reminds her that your bond is unbroken, enduring and ever-growing. This Lab Grown Ruby Ring becomes a subtle yet powerful statement, whether paired with other jewelry or worn alone, it radiates romance, elegance and a promise that lasts a lifetime. This Lab Ruby and Diamond Eternity Ring comes in a signature jewelry box, ready to become a cherished gift for anniversaries, milestones or spontaneous moments that deserve celebration. With multiple ring sizes available, you can choose the perfect fit to make it uniquely hers. This Infinity Ring is a shining symbol of eternal devotion, a treasure that captures love, passion and commitment in one breathtaking design, destined to be worn for years to come.

Product Information
SKU SHP-RINGS032226720
Metal Weight 2.90 gm (Approximate)
Total Stone Weight 2.09 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 4 Pieces
Total Weight 1.36 Carat (Approximate)
Dimension(approx) Round-4X4 mm-4 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 56 Pieces
Total Weight 0.73 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-56 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stone-shape-swatches