Certified Lab Grown Diamond Flower Promise Ring For Women

Regular price £787.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Promise with Contemporary Meaning

This certified lab grown diamond flower promise ring is designed for those who prefer symbolism expressed through form rather than excess. The floral motif represents growth and commitment, making it a thoughtful choice for a promise ring that feels personal yet refined.

Its balanced composition allows the design to feel expressive without overwhelming the hand, making it suitable for daily wear or milestone gifting.

Structured Flower Design

The flower-inspired setting arranges diamonds in a composed pattern, creating symmetry and visual cohesion. Each stone works together to form a unified shape rather than a single focal point, giving the ring a soft architectural presence.

The structure ensures the ring maintains proportion and stability, offering both visual appeal and practical wearability.

Light Behavior: Layered Sparkle

Unlike a traditional solitaire, the clustered floral layout produces layered sparkle. Light reflects from multiple directions across the petal-like arrangement, creating dimension and a gentle, distributed brilliance.

This controlled shimmer enhances the ring’s symbolic form while maintaining a refined finish.

Lab Grown Diamond Considerations

Lab grown diamonds share the same chemical and optical properties as mined diamonds. They are created without traditional mining, though impact varies by production and energy source.

When properly cared for, lab grown diamonds are suitable for regular wear, making them a practical choice for promise jewelry intended to be worn often.

Product Information
SKU SHP-RINGS022510014
Width 5 mm
Height 10 mm
Metal Weight 2.90 gm (Approximate)
Total Stone Weight 0.41 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.41 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Round-1.60X1.60 mm-8 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs About: Certified Lab Grown Diamond Flower Promise Ring For Women

Is this ring suitable for everyday wear?
Yes, the structured setting and durable diamond composition make it appropriate for daily wear when handled with standard jewelry care.
What does a flower design symbolize in a promise ring?
A floral motif commonly represents growth, renewal, and evolving commitment, making it meaningful for promise jewelry.
Are lab grown diamonds real diamonds?
Yes, lab grown diamonds have the same physical and chemical properties as mined diamonds.
Can this ring be resized?
Resizing depends on the specific design structure. Please refer to the product details or consult customer support for confirmation.
How should I clean this ring?
Clean gently using warm water and mild soap, then dry with a soft cloth. Avoid abrasive materials or harsh chemicals.