Certified Lab Grown Emerald Diamond Flower Engagement Ring With Diamonds

Regular price £901.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

The Certified Lab Grown Emerald Diamond Flower Engagement Ring with Diamonds blends vibrant color with a nature-inspired silhouette. At its center, a lab grown emerald is framed within a floral motif, accented by diamonds that add refined brilliance and contrast.

Floral Design & Setting

The flower-inspired arrangement creates a soft yet structured appearance, with carefully placed diamonds forming petal-like detailing around the emerald. This design draws the eye inward while maintaining a balanced profile on the finger. The combination of color and sparkle results in an engagement ring that feels distinctive without overwhelming the center stone.

About Lab Grown Emerald & Diamonds

Lab grown emeralds offer the vivid green appearance associated with emerald while being created without traditional mining. Environmental impact varies by production and energy source. Diamond accents are valued for their durability and light performance, making them suitable companions for engagement jewelry intended for long-term wear.

Key Highlights

  • Lab grown emerald center: vibrant green focal point.
  • Floral-inspired design: diamond accents arranged in a flower motif.
  • Certified gemstone: documented grading for quality reference.
  • Balanced sparkle: diamonds enhance brilliance without overpowering the center.
Product Information
SKU SHP-RINGS032224618
Width 11 mm
Height 4.2 mm
Metal Weight 3.00 gm (Approximate)
Center Stone Weight 0.85 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.85 Carat (Approximate)
Dimension(approx) Oval-5X7 mm-1 Pcs
Color Green
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 22 Pieces
Total Weight 0.26 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-12 Pcs
Round-1.30X1.30 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stone-shape-swatches

FAQs About: Certified Lab Grown Emerald Diamond Flower Engagement Ring With Diamonds

What does lab grown emerald mean?
A lab grown emerald is created in a controlled environment to replicate the properties and appearance of natural emerald, without traditional mining.
Is this ring suitable for daily wear?
With proper care, this engagement ring can be worn regularly. Avoiding impact and harsh chemicals helps maintain the appearance of both emerald and diamonds.
What makes a flower engagement ring unique?
A flower engagement ring arranges accent stones in a petal-like formation around the center gem, creating a distinctive, nature-inspired design.
Are the diamonds in this ring durable?
Diamonds are known for their durability and brilliance, making them well suited for engagement jewelry intended for long-term wear.
Who is this ring best suited for?
This ring is ideal for someone who appreciates vibrant green color and a floral-inspired engagement design with diamond accents.