Certified Lab Grown Ruby Ring Guard with Diamond

Regular price £624.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate love with a nature-inspired touch in this elegant Ruby Stackable Ring. Thoughtfully designed to resemble a delicate leaf, this stunning ring beautifully combines natural beauty with modern sophistication, making it a perfect choice for romantics and nature lovers alike. It features a brilliant round lab created diamond, secured in prong setting. Nestled above the diamond are three striking pear shaped lab created rubies, set to create a graceful, leaf-like silhouette. Their rich, deep red hues bring passion and warmth to the Ruby Ring Enhancer, offering a beautiful contrast to the icy brilliance of the diamond. The band itself is shaped in a chevron or V silhouette, gracefully wrapping around the finger. Crafted with precision and finished in high-polish metal, the ring’s minimalist band allows the gemstones to truly shine. Whether worn as a unique stackable Engagement Ring Enhancer or a symbolic statement piece, this beauty is as meaningful as it is beautiful. With its vibrant color palette and symbolic leaf motif, this Ruby and Diamond Ring captures the essence of growth, love, and a new beginning - making it a heartfelt treasure she will adore forever.

Product Information
SKU SHP-RINGS0821184979
Width 2.2 mm
Height 11.7 mm
Metal Weight 2.11 gm (Approximate)
Total Stone Weight 0.97 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 3 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-3 Pcs
Color Red
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.07 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
anniversary-rings