Certified Natural Diamond Infinity Band Ring

Regular price £1,165.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

The Certified Natural Diamond Infinity Band Ring is designed to express continuity and enduring connection through a refined silhouette. The flowing infinity motif forms the foundation of the band, while natural diamonds introduce brilliance that highlights each curve.

Design & Infinity Setting

The infinity symbol is widely associated with eternity and lasting bonds. In this band design, the repeated infinity pattern creates visual rhythm and balance around the finger. Diamonds are carefully set to accent the contours of the motif, enhancing light reflection while maintaining a cohesive structure.

About Natural Diamonds

Natural diamonds are valued for their durability and ability to maintain brilliance over time. Their strength makes them suitable for meaningful jewelry intended for regular wear. Each diamond contributes subtle individuality to the overall band while preserving a unified appearance.

Key Highlights

  • Infinity band design: symbolic and timeless motif.
  • Certified natural diamonds: enduring brilliance and strength.
  • Balanced band structure: refined proportions for daily styling.
  • Meaningful jewelry piece: suitable for anniversaries or milestone moments.
Product Information
SKU SHP-RINGS012210013
Metal Weight 4.30 gm (Approximate)
Total Stone Weight 0.14 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 24 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-1X1 mm-24 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave Setting
Quality Grade SI
View More

Product Parent Collection Handle
men-ring

FAQs About: Certified Natural Diamond Infinity Band Ring

What does an infinity band ring symbolize?
The infinity symbol is commonly associated with eternity, unity, and lasting connection, making it a meaningful choice for significant occasions.
Are the diamonds in this ring natural?
This ring features certified natural diamonds, known for their durability and light performance.
Is this band suitable for everyday wear?
Natural diamonds are commonly selected for daily-wear jewelry. Proper care helps preserve the appearance and finish of the band over time.
Can this ring be worn as a wedding or anniversary band?
The infinity motif and diamond detailing make this band a meaningful option for weddings, anniversaries, or milestone celebrations.
Who is this ring best suited for?
This ring is ideal for someone seeking a symbolic band design that combines timeless meaning with the brilliance of natural diamonds.