Certified Real Diamond Flower Earrings with Screw Back

Regular price £514.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Capture attention with the sparkle of these Diamond Flower Earrings, a radiant blend of charm and elegance designed to brighten every moment. Each Earring features a delicate Flower motif adorned with petite Diamond stones, creating a graceful shimmer that feels both feminine and timeless. The sparkling Diamond stones dance with the light, bringing the floral design to life in a way that is subtle yet captivating. Crafted with secure Screw Back Closure, these Flower Stud Earrings offer comfort and confidence, making them perfect for everyday wear or special occasions where you want to add a touch of refined beauty. Arriving in a beautifully presented jewelry box, these Diamond Stud Earrings make a thoughtful and heartfelt gift, ideal for birthdays, anniversaries, holidays or reminding someone how cherished they are. Elegant and wonderfully versatile, these Diamond Earrings for Women are a piece she will treasure and reach for time and time again.

Product Information
SKU SHP-EARRINGS082210005
Metal Weight 1.40 gm (Approximate)
Total Stone Weight 0.29 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 48 Pieces
Total Weight 0.29 Carat (Approximate)
Dimension(approx) Round-1X1 mm-48 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-earrings