Certified Round Lab Grown Emerald Flower Promise Ring

Regular price £759.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Express your feelings to her with an adorable Promise Ring that captures the beauty of nature, just like this Lab Emerald Flower Ring. Featuring a 6 mm Round Shape Lab Created Emerald as a centerpiece in a flower motif, that commands attention. The rich green Lab Emerald symbolizes balance, growth and everlasting love, while the Flower motif adds freshness of nature to the design that makes a statement. The sleek band keeps the focus on the striking AAAA Quality Lab Emerald, perfect for someone who loves bold yet graceful style with a touch of nature-inspired details. Designed for beauty, this Lab Grown Emerald Ring offers a lasting shine and significance. This Lab Emerald Proposal Ring is available in various ring sizes to ensure the ideal fit. Presented in an elegant Jewelry Box, this Commitment Ring for her is a symbol of your unique love story, thoughtfully designed to celebrate nature, passion and a bright future together.

Product Information
SKU SHP-RINGS082223748
Metal Weight 2.87 gm (Approximate)
Center Stone Weight 0.80 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
stone-shape-swatches