Contemporary Diamond Stud Earrings with Certificate

Regular price £624.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Adorn yourself with the delicate elegance of these Diamond Stud Earrings, thoughtfully designed to capture hearts. Each earring features a graceful leaf like motif, adorned with dazzling Diamond stones that shimmer subtly with every movement. The Screw Back Closure ensures they stay secure and comfortable, perfect for all-day wear, whether you are at the office, attending a special event or enjoying a casual outing. Their versatile design makes them easy to pair with anything, from a chic evening dress to your everyday wardrobe. These Diamond Ear Studs also make a meaningful and stylish gift, arriving in a sleek jewelry box ready to impress and delight. The contemporary design blends modern flair with timeless elegance, making these Diamond Studs a piece that can be treasured for years to come.

Product Information
SKU SHP-EARRINGS082210211
Metal Weight 1.70 gm (Approximate)
Total Stone Weight 0.15 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 24 Pieces
Total Weight 0.15 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-8 Pcs
Round-0.90X0.90 mm-4 Pcs
Round-1.10X1.10 mm-8 Pcs
Round-1X1 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-earrings